PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0187859.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 259aa    MW: 29187.7 Da    PI: 6.9471
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0187859.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM104.91.1e-3227357129
              NAM  57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ewyfFs+rd+ky++g+r+nrat+sgyWkatgk ++v s ++++vg+kktLv+y+grap+g++t+Wvmheyrle
  Lj0g3v0187859.1   2 EWYFFSPRDRKYPNGSRTNRATNSGYWKATGKPRKVNS-QDRAVGMKKTLVYYRGRAPHGSRTNWVMHEYRLE 73 
                      8*************************************.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.158195IPR003441NAC domain
SuperFamilySSF1019413.4E-38295IPR003441NAC domain
PfamPF023652.7E-16372IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MEWYFFSPRD RKYPNGSRTN RATNSGYWKA TGKPRKVNSQ DRAVGMKKTL VYYRGRAPHG  60
SRTNWVMHEY RLEERECETP SGLQDAYALC RVIKKSEVIA PKVGGYCANM TSHAHQITSD  120
QSSSIELYSE GRGEDLDSSN YLMPIDTFSP HNMANESSLN INSGTPFSSE DSLFSLPTSS  180
FPNFGAITYP PSKVDIALEC ARMQHRFTLP PLQVENFPQV GIPEMQMTQT SGAMQRTETD  240
ILQEILSVAH ASQDLMNHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-3529572165NO APICAL MERISTEM PROTEIN
1ut4_B7e-3529572165NO APICAL MERISTEM PROTEIN
1ut7_A7e-3529572165NO APICAL MERISTEM PROTEIN
1ut7_B7e-3529572165NO APICAL MERISTEM PROTEIN
3swm_A7e-3529575168NAC domain-containing protein 19
3swm_B7e-3529575168NAC domain-containing protein 19
3swm_C7e-3529575168NAC domain-containing protein 19
3swm_D7e-3529575168NAC domain-containing protein 19
3swp_A7e-3529575168NAC domain-containing protein 19
3swp_B7e-3529575168NAC domain-containing protein 19
3swp_C7e-3529575168NAC domain-containing protein 19
3swp_D7e-3529575168NAC domain-containing protein 19
4dul_A7e-3529572165NAC domain-containing protein 19
4dul_B7e-3529572165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014624970.11e-145PREDICTED: NAC domain-containing protein 86 isoform X3
SwissprotA4VCM03e-57NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A0B2S8G91e-143A0A0B2S8G9_GLYSO; NAC domain-containing protein 74
STRINGGLYMA02G40750.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-78NAC domain containing protein 28